Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE)

This Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

P77179

Expression Region

1-231

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGN38B Double Nickase Plasmid (m2)
sc-423542-NIC-2 20 µg

TGN38B Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
SCF, Rat (His)
HY-P72480-01 10 µg

SCF, Rat (His)

Sign In for Pricing
View Details
SCF, Rat (His)
HY-P72480-02 50 µg

SCF, Rat (His)

Sign In for Pricing
View Details
KCNQ4 shRNA (h) Lentiviral Particles
sc-42503-V 200 µL

KCNQ4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
PD-L1 (CD274) Human Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C8]
TA813015BM 100 µL

PD-L1 (CD274) Human Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C8]

Sign In for Pricing
View Details
CKS1BP sgRNA CRISPR Lentivector (Human) (Target 2)
K0456603 1.0 µg DNA

CKS1BP sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details