Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (His) is the recombinant rat-derived SCF protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC4 Antibody, Biotin conjugated
A67176-100UG 100 µg

DNAJC4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ERK1 Rabbit rabbit pAb
ES20758-01 50 µL

ERK1 Rabbit rabbit pAb

Sign In for Pricing
View Details
ERK1 Rabbit rabbit pAb
ES20758-02 100 µL

ERK1 Rabbit rabbit pAb

Sign In for Pricing
View Details
LL/2 Luciferase Reporter Cell Line
ABC-RC641H 1 Vial

LL/2 Luciferase Reporter Cell Line

Sign In for Pricing
View Details
NT5C2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1459304 1.0 µg DNA

NT5C2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Ribonuclease HIII (rnhC)
MBS1453659-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis Ribonuclease HIII (rnhC)

Sign In for Pricing
View Details