Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q9MUN7

Expression Region

1-236

Origin

Mesostigma viride

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINNQESLRSQTFFCIKYIISLSFFFILIYQLLNFLVLRPYAEYLWNHYQTDVFLNSSQE ERIFAKLQNFEEEMQFDMLISYTYPLNPQVLHKEMEEKAFELAHMSNNESINSIAHVFTD LLIAFLIFCLLINAKKEIAIIQTYIDQYIYSLTDAKKSFFLILFTDIFVGFHSSHGWKIL IELCLTHLGLPENKGFIFLFVATFPVILDTLFKYWIFLYLNRISPSAVATFNNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sh2d3c Mouse Gene Knockout Kit (CRISPR)
KN515703 1 Kit

Sh2d3c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dicer (DICER1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D9]
TA801633AM 100 µL

Dicer (DICER1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D9]

Sign In for Pricing
View Details
AI429214 Mouse Gene Knockout Kit (CRISPR)
KN501023 1 Kit

AI429214 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Presenilin 2 (PSEN2) Human Gene Knockout Kit (CRISPR)
KN402921 1 Kit

Presenilin 2 (PSEN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HotPlate Magnetic Stirrer BHMS-201
BHMS-201 1 Unit

HotPlate Magnetic Stirrer BHMS-201

Sign In for Pricing
View Details
RUNX3 Mouse Monoclonal Antibody [A7B7]
HA600058 100 µL

RUNX3 Mouse Monoclonal Antibody [A7B7]

Sign In for Pricing
View Details