Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat CD63 antigen (CD63)

This Recombinant Cat CD63 antigen (CD63) spans the amino acid sequence from region 2-238.

Product Specifications

Product Name Alternative

CD63 antigen, CD_antigen= CD63

UniProt

Q76B49

Expression Region

2-238

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLRQTIVQGATPGSLLPVVIIAVG AFLFLVAFVGCCGACKENYCLMVTFAIFLSLIMLVEVAVAIAGYVFRDKVMSEFNKDFRQ QMQNYPKNNHTVSIVDRMQEDFKCCGAANYTDWGSIPLMSKARVPDSCCVNVTQGCGISF KVKEIHEEGCVEKIGGWLRSNVLVVAAAALGIAFVEVLGIIFACCLVKSIRSGYEVM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Herpotrichone A
HY-N10275 1 Each

Herpotrichone A

Sign In for Pricing
View Details
Human CAMKK2 (NM_172214) AAV Particle
RC215581A1V 250 µL

Human CAMKK2 (NM_172214) AAV Particle

Sign In for Pricing
View Details
HNRNPA1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV808162 1.0 µg DNA

HNRNPA1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
KCNMA1 (Calcium-activated Potassium Channel Subunit alpha-1, Potassium Large Conductance Calcium-activated Channel, Subfamily M, alpha Member 1)
484013 100 µL

KCNMA1 (Calcium-activated Potassium Channel Subunit alpha-1, Potassium Large Conductance Calcium-activated Channel, Subfamily M, alpha Member 1)

Sign In for Pricing
View Details
Primate IL5 protein
orb419312-01 10 µg

Primate IL5 protein

Sign In for Pricing
View Details
Primate IL5 protein
orb419312-02 100 µg

Primate IL5 protein

Sign In for Pricing
View Details