Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Membrane protein insertase YidC 1 (yidC1)

This Recombinant Bacillus halodurans Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 21-257.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q9RCA5

Expression Region

21-257

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CFNVNEPINAQSEGIWDSYFVYPLSWLMIYFANAFNGSFGLAIIVVTLLIRLLILPLMIK QLKSTRAMQALQPEMQALREKYSAKDQRTQQKLQQETMALFQKHGVNPLAGCFPVLIQMP ILLAFYHAIMRTREIGDEHFLWFVLNQPDPILLPIIAGITTFLQQKMMMVTDNPQMKVLL YVMPVMILVFAMFLPSSLALYWVIGNLFMILQTYFITGPNVGAKKVAADVKVGGKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM1 Antibody
OC-550-01 50 μL

CEACAM1 Antibody

Sign In for Pricing
View Details
CEACAM1 Antibody
OC-550-02 100 µL

CEACAM1 Antibody

Sign In for Pricing
View Details
CEACAM1 Antibody
OC-550-03 1 mL

CEACAM1 Antibody

Sign In for Pricing
View Details
AAV Quantification Kit
63800 24 Reactions

AAV Quantification Kit

Sign In for Pricing
View Details
Relcovaptan
TRC-R143310-50MG 50 mg

Relcovaptan

Sign In for Pricing
View Details
SLC7A3 (NM_001048164) Human Over-expression Lysate
LY420766 100 µg

SLC7A3 (NM_001048164) Human Over-expression Lysate

Sign In for Pricing
View Details