Recombinant Streptococcus pyogenes serotype M4 ATP synthase subunit a (atpB)
This Recombinant Streptococcus pyogenes serotype M4 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
Q1J7G4
Expression Region
1-238
Origin
Streptococcus pyogenes serotype M4 (strain MGAS10750)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFV DGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLA LSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEV VTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFTKLTATYLGKKVNESEE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
108901J0-AAT 100 Tests
TRITC Anti-human/ non-human primates CD89 Antibody *A59*
Sign In for Pricing
View Details 
034547-HRP 200 µL
DDX20, CT (DDX20, DP103, GEMIN3, Probable ATP-dependent RNA helicase DDX20, Component of gems 3, DEAD box protein 20, DEAD box protein DP 103, Gemin-3) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 