Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit a (atpB)

This Recombinant Streptococcus pneumoniae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P0A2Y9

Expression Region

1-238

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFV IGFTEPNIGSRYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLT LSFLVILLTHIESVRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEV MTSLLLLLSHQAIYWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYLGNKINIEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antibiofilm agent-13
HY-168258 1 Each

Antibiofilm agent-13

Sign In for Pricing
View Details
COL1A2 Antibody
CSB-PA001742-01 50 µg

COL1A2 Antibody

Sign In for Pricing
View Details
COL1A2 Antibody
CSB-PA001742-02 100 µg

COL1A2 Antibody

Sign In for Pricing
View Details
Cat Peptide Major Histocompatibility Complex (PMHC) ELISA Kit
MBS9939795 Inquire

Cat Peptide Major Histocompatibility Complex (PMHC) ELISA Kit

Sign In for Pricing
View Details
NFYB (Nuclear Transcription Factor Y Subunit beta, CAAT Box DNA-binding Protein Subunit B, Nuclear Transcription Factor Y Subunit B, NF-YB, HAP3) (MaxLight 405)
MBS6191431-01 0.1 mL

NFYB (Nuclear Transcription Factor Y Subunit beta, CAAT Box DNA-binding Protein Subunit B, Nuclear Transcription Factor Y Subunit B, NF-YB, HAP3) (MaxLight 405)

Sign In for Pricing
View Details
NFYB (Nuclear Transcription Factor Y Subunit beta, CAAT Box DNA-binding Protein Subunit B, Nuclear Transcription Factor Y Subunit B, NF-YB, HAP3) (MaxLight 405)
MBS6191431-02 5x 0.1 mL

NFYB (Nuclear Transcription Factor Y Subunit beta, CAAT Box DNA-binding Protein Subunit B, Nuclear Transcription Factor Y Subunit B, NF-YB, HAP3) (MaxLight 405)

Sign In for Pricing
View Details