Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Tetraspanin-7 (TSPAN7)

This Recombinant Pongo pygmaeus Tetraspanin-7 (TSPAN7) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Tetraspanin-7, Tspan-7, Transmembrane 4 superfamily member 2, CD_antigen= CD231

UniProt

Q7YQK9

Expression Region

1-244

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGT GTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYT DAMQTYDGKDDRSQAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQD LHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQ YEMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-12 p40/IL-12B Protein
PKSH032004-01 10 µg

Recombinant Human IL-12 p40/IL-12B Protein

Sign In for Pricing
View Details
Recombinant Human IL-12 p40/IL-12B Protein
PKSH032004-02 50 µg

Recombinant Human IL-12 p40/IL-12B Protein

Sign In for Pricing
View Details
HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: J2E1]
AM09063PU-N 100 µL

HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: J2E1]

Sign In for Pricing
View Details
Recombinant Human DAPK3/ZIPK Protein (GST Tag)
PKSH030384 50 µg

Recombinant Human DAPK3/ZIPK Protein (GST Tag)

Sign In for Pricing
View Details
1H-Indole-2,3-dione
TRC-I627060-10G 10 g

1H-Indole-2,3-dione

Sign In for Pricing
View Details
Ki67 (MKI67) Mouse Monoclonal Antibody [Clone ID: 8D5]
AM06511SU-N 100 µL

Ki67 (MKI67) Mouse Monoclonal Antibody [Clone ID: 8D5]

Sign In for Pricing
View Details