Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Derlin-1 (cup-2)

This Recombinant Derlin-1 (cup-2) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Derlin-1, Coelomocyte uptake defective protein 2, DER1-like protein 1, cDerlin-1

UniProt

Q93561

Expression Region

1-245

Origin

Caenorhabditis elegans

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIY YPVTPQTGFHWLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFL LEPMVISVLYVWCQVNKDTIVSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGH AYFFVALKYPDEYGVDLISTPEFLHRLIPDEDGGIHGQDGNIRGARQQPRGHQWPGGVGA RLGGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRPF3 Rabbit Polyclonal Antibody (APC-Cy7)
orb2383642 100 µL

BRPF3 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Phospho-Girdin (Tyr1765) Rabbit Polyclonal Antibody (Biotin)
orb501969 100 µL

Phospho-Girdin (Tyr1765) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
USF2 Peptide - middle region
orb1998044 100 µg

USF2 Peptide - middle region

Sign In for Pricing
View Details
RECS1 Polyclonal Antibody
JOT-AP07730-01 20 µL

RECS1 Polyclonal Antibody

Sign In for Pricing
View Details
RECS1 Polyclonal Antibody
JOT-AP07730-02 50 μL

RECS1 Polyclonal Antibody

Sign In for Pricing
View Details
RECS1 Polyclonal Antibody
JOT-AP07730-03 100 µL

RECS1 Polyclonal Antibody

Sign In for Pricing
View Details