Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USF2 Peptide - middle region

USF2 Peptide - middle region

Product Specifications

Product Name Alternative

Usf-2, bHLHb12

UniProt

Q64705

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035810.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCHADNSKTGASK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LMO1 sgRNA gene knockout kit - Lentiviral human LMO1 sgRNA gene knockout kit (plasmid)
GTR15384278 1 Vial

Lentiviral human LMO1 sgRNA gene knockout kit - Lentiviral human LMO1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Caspase-8/CASP8 Rabbit Polyclonal Antibody (Fluoro647)
orb3081986 100 µg

Caspase-8/CASP8 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
TRNAE7 3'UTR GFP Stable Cell Line
TU076733 1.0 mL

TRNAE7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ALX 40-4C
TP1364-01 1 mg

ALX 40-4C

Sign In for Pricing
View Details
ALX 40-4C
TP1364-02 5 mg

ALX 40-4C

Sign In for Pricing
View Details
3-Methylpentanoic-d11 acid
426460 25 mg

3-Methylpentanoic-d11 acid

Sign In for Pricing
View Details