Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus ATP synthase subunit a (atpB)

This Recombinant Synechococcus elongatus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q31RF6

Expression Region

1-249

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLLELSSVLPLAELEVGQHFYWQIGNYRLHGQVFLTSWFVIAALVVLSLLANRNLQRI PSGLQNFMEYVLDFIRNLARTQIGEKEYRPWVPFIGTLFLFIFLSNWSGALIPWKLIKLP SGELAAPTSDINTTVALALLTSLAYFYAGFSRKGLGYFGNYVHPTPVMLPFKILEDFTKP LSLSFRLFGNILADELVVAVLVLLVPLFVPLPAMILGLFTSAIQALIFATLAASYIGEAV EEHGEEHAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PKC beta 2 Monoclonal Antibody
E-AB-81518-01 50 µL

Recombinant PKC beta 2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PKC beta 2 Monoclonal Antibody
E-AB-81518-02 100 µL

Recombinant PKC beta 2 Monoclonal Antibody

Sign In for Pricing
View Details
LAP2 (TMPO) (NM_001032283) Human Recombinant Protein
TP720158M 50 µg

LAP2 (TMPO) (NM_001032283) Human Recombinant Protein

Sign In for Pricing
View Details
Tris[2-(perfluorohexyl)ethyl] Phosphate
TRC-T886350-10MG 10 mg

Tris[2-(perfluorohexyl)ethyl] Phosphate

Sign In for Pricing
View Details
GSK3 alpha (GSK3A) Rabbit Polyclonal Antibody
AP20981PU-N 100 µg

GSK3 alpha (GSK3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mok Mouse Gene Knockout Kit (CRISPR)
KN516876 1 Kit

Mok Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details