Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin domain-containing protein 1 (CLDND1)

This Recombinant Human Claudin domain-containing protein 1 (CLDND1) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Claudin domain-containing protein 1, Membrane protein GENX-3745

UniProt

Q9NY35

Expression Region

1-253

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEAD EKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFV DPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLA GLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTN RKEYTLMKAYRVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Necrostatin
SIH-213-50MG 50 mg

Necrostatin

Sign In for Pricing
View Details
Human KHDC1 activation kit by CRISPRa
GA112971 1 Kit

Human KHDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
CACNG7 (NM_031896) Human Over-expression Lysate
LC403128 20 µg

CACNG7 (NM_031896) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-MCM2 (S41) Recombinant Rabbit Monoclonal Antibody [JE50-04]
HA722279 100 µL

Phospho-MCM2 (S41) Recombinant Rabbit Monoclonal Antibody [JE50-04]

Sign In for Pricing
View Details
HBB Mouse Monoclonal Antibody [Clone ID: 15C2.C11.F2.G11]
TA396794S 25 µL

HBB Mouse Monoclonal Antibody [Clone ID: 15C2.C11.F2.G11]

Sign In for Pricing
View Details
Recombinant HSD17B1 Antibody
RC-5250-01 50 μL

Recombinant HSD17B1 Antibody

Sign In for Pricing
View Details