Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Surfeit locus protein 4 (SURF4)

This Recombinant Human Surfeit locus protein 4 (SURF4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

O15260

Expression Region

1-269

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWN CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACES Buffer 0.5M, pH 7.0
40120003-2 250 mL

ACES Buffer 0.5M, pH 7.0

Sign In for Pricing
View Details
Zinc arsenate octahydrate
sc-302002A 50 g

Zinc arsenate octahydrate

Sign In for Pricing
View Details
Human AHSA2 knockout cell line
ABC-KH0427 1 Vial

Human AHSA2 knockout cell line

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri argH Protein (aa 1-438) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
VAng-Lsx9411-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri argH Protein (aa 1-438) (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Sign In for Pricing
View Details
IL10RA Mouse Monoclonal Antibody [Clone ID: LBI1C12]
AMM14057VCF 100 µg

IL10RA Mouse Monoclonal Antibody [Clone ID: LBI1C12]

Sign In for Pricing
View Details
Cyclophilin E/PPIE Mouse Monoclonal Antibody (Biotin)
orb2600414 100 µg

Cyclophilin E/PPIE Mouse Monoclonal Antibody (Biotin)

Sign In for Pricing
View Details