Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-17 (Tspan17)

This Recombinant Mouse Tetraspanin-17 (Tspan17) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Tetraspanin-17, Tspan-17, F-box only protein 23, Tetraspan protein SB134, Transmembrane 4 superfamily member 17

UniProt

Q9D7W4

Expression Region

1-270

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGKHQQFQDPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG LDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDW IRDQLNLFINNNVKAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQEGSIYTKGCVGQFEKWLQDNLIVVAG VLVGIALLQIFGLCLAQNLVSDIKAVKANW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ZFYVE21 shRNA Plasmid
abx990444-01 150 µg

Rat ZFYVE21 shRNA Plasmid

Sign In for Pricing
View Details
Rat ZFYVE21 shRNA Plasmid
abx990444-02 300 µg

Rat ZFYVE21 shRNA Plasmid

Sign In for Pricing
View Details
Goat G Patch Domain-Containing Protein 1 (GPATCH1) ELISA Kit
MBS9371098 Inquire

Goat G Patch Domain-Containing Protein 1 (GPATCH1) ELISA Kit

Sign In for Pricing
View Details
Troponin I (TnI) Antibody
abx414587 200 µg

Troponin I (TnI) Antibody

Sign In for Pricing
View Details
MSH5 Rabbit Polyclonal Antibody
E53P06990 100 µL

MSH5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acetyl-HIST1H2AG (K5) Polyclonal Antibody
CAC15169-01 50 µL

Acetyl-HIST1H2AG (K5) Polyclonal Antibody

Sign In for Pricing
View Details