Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-17 (Tspan17)

This Recombinant Mouse Tetraspanin-17 (Tspan17) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Tetraspanin-17, Tspan-17, F-box only protein 23, Tetraspan protein SB134, Transmembrane 4 superfamily member 17

UniProt

Q9D7W4

Expression Region

1-270

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGKHQQFQDPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG LDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDW IRDQLNLFINNNVKAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQEGSIYTKGCVGQFEKWLQDNLIVVAG VLVGIALLQIFGLCLAQNLVSDIKAVKANW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHP2/PTPN11 Rabbit Polyclonal Antibody (Biotin)
orb2579841 100 µg

SHP2/PTPN11 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RPL21P103 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1932808 1.0 µg DNA

RPL21P103 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ZP2 Recombinant Protein (Human)
RP045376 100 µg

ZP2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Gm5141 3'UTR GFP Stable Cell Line
TU158177 1.0 mL

Gm5141 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MeV H Polyclonal Antibody, APC-Cy7 Conjugated
bs-42169R-APC-Cy7 100 µL

MeV H Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Salpyran hydrochloride
T81223-01 5 mg

Salpyran hydrochloride

Sign In for Pricing
View Details