Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-17 (Tspan17)

This Recombinant Mouse Tetraspanin-17 (Tspan17) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Tetraspanin-17, Tspan-17, F-box only protein 23, Tetraspan protein SB134, Transmembrane 4 superfamily member 17

UniProt

Q9D7W4

Expression Region

1-270

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGKHQQFQDPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG LDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDW IRDQLNLFINNNVKAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQEGSIYTKGCVGQFEKWLQDNLIVVAG VLVGIALLQIFGLCLAQNLVSDIKAVKANW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabeprazole Impurity 55
RM-R021655-01 10 mg

Rabeprazole Impurity 55

Sign In for Pricing
View Details
Rabeprazole Impurity 55
RM-R021655-02 25 mg

Rabeprazole Impurity 55

Sign In for Pricing
View Details
Rabeprazole Impurity 55
RM-R021655-03 50 mg

Rabeprazole Impurity 55

Sign In for Pricing
View Details
Rabeprazole Impurity 55
RM-R021655-04 100 mg

Rabeprazole Impurity 55

Sign In for Pricing
View Details
Cleaved-Caspase-4/5 p20 (D270/D311) Polyclonal Antibody
E20-10029 100 µg

Cleaved-Caspase-4/5 p20 (D270/D311) Polyclonal Antibody

Sign In for Pricing
View Details
Human SIPA1L1 Knockout HEK293T cell line
GTR15408482 1 Vial

Human SIPA1L1 Knockout HEK293T cell line

Sign In for Pricing
View Details