Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q6GEY5

Expression Region

20-290

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad4 Peptide - C-terminal region
orb2003546 100 µg

Smad4 Peptide - C-terminal region

Sign In for Pricing
View Details
Lentiviral mouse Cbfb shRNA (UAS) - Lentiviral mouse Cbfb shRNA (UAS) plasmid
GTR15265579 1 Vial

Lentiviral mouse Cbfb shRNA (UAS) - Lentiviral mouse Cbfb shRNA (UAS) plasmid

Sign In for Pricing
View Details
SHENTEK® Residual E1B DNA Quantitation Kit
1101110 100 Reactions

SHENTEK® Residual E1B DNA Quantitation Kit

Sign In for Pricing
View Details
DNAJC7 Antibody
orb1258057 100 µL

DNAJC7 Antibody

Sign In for Pricing
View Details
Influenza A H3N2 (A/X-31) Hemagglutinin / HA Protein (His Tag)
PO54882M2 100 µg

Influenza A H3N2 (A/X-31) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
3-Nitro-4- (trifluoroacetamido) benzene-1-sulfonyl chloride
DXB64796-01 250 mg

3-Nitro-4- (trifluoroacetamido) benzene-1-sulfonyl chloride

Sign In for Pricing
View Details