Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smad4 Peptide - C-terminal region

Smad4 Peptide - C-terminal region

Product Specifications

UniProt

E3SRG8

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMAD4 Rabbit Polyclonal Antibody (orb576759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Benzenesulfonyl-5-chloro-3-iodo-1H-pyrrolo[2,3-b]pyridine
sc-303160 100 mg

1-Benzenesulfonyl-5-chloro-3-iodo-1H-pyrrolo[2,3-b]pyridine

Sign In for Pricing
View Details
Human TSTA3 / GDP-L-Fucose Synthase Recombinant Protein
MBS2902760 Inquire

Human TSTA3 / GDP-L-Fucose Synthase Recombinant Protein

Sign In for Pricing
View Details
NOX2 Rabbit Polyclonal Antibody (RBITC)
orb1046474 100 µL

NOX2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Mouse ATP5H siRNA
abx908579-01 15 nmol

Mouse ATP5H siRNA

Sign In for Pricing
View Details
Mouse ATP5H siRNA
abx908579-02 30 nmol

Mouse ATP5H siRNA

Sign In for Pricing
View Details
AKR1D1 Rabbit Polyclonal Antibody
orb654307 100 µg

AKR1D1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details