Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius ATP synthase subunit a (atpB)

This Recombinant Sodalis glossinidius ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2NQ92

Expression Region

1-272

Origin

Sodalis glossinidius (strain morsitans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASGEISTPQEYIGHHLNNLQLDMRTFELVNHHTASSFWVLNIDSMFFSLLLGAIFLLI FGRVAKGATSGVPGKMQTFVELVVGFVDGSVRDMFHGKSKLIAPLALTIFVWVFLMNLMD LLPIDLLPYLGEHVLGLPALRVVPSADVNITLSMALGVFILILYYSVMMKGIGGFVKELT LQPFNHPIFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNV PWAIFHILIITLQAFIFMVLTIVYLAMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPPK1 Human Gene Knockout Kit (CRISPR)
KN212630 1 Kit

EPPK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human IFN-λ1/IL-29 Protein (His Tag)
PKSH033639-01 10 µg

Recombinant Human IFN-λ1/IL-29 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IFN-λ1/IL-29 Protein (His Tag)
PKSH033639-02 50 µg

Recombinant Human IFN-λ1/IL-29 Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS707833 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS645721 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
TRAF6 (NM_004620) Human Recombinant Protein
TP319528L 1 mg

TRAF6 (NM_004620) Human Recombinant Protein

Sign In for Pricing
View Details