Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q663Q2

Expression Region

1-274

Origin

Yersinia pseudotuberculosis

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASGEISTPRDYIGHHLNHLQLDLRTFELVNPHSTGPATFWTLNIDSLFFSVVLGLAFL LVFRKVAASATSGVPGKLQTAVELIIGFVDNSVRDMYHGKSKVIAPLALTVFVWVLLMNM MDLLPIDLLPYIGEHVFGLPALRVVPTADVSITLSMALGVFILIIFYSIKMKGVGGFTKE LTMQPFNHPIFIPVNLILEGVSLLSKPLSLGLRLFGNMYAGELIFILIAGLLPWWSQWML SVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF5 (Ras Association Domain-containing Protein 5, New Ras Effector 1, Regulator for Cell Adhesion and Polarization Enriched in Lymphoid Tissues, RAPL, NORE1, MGC10823, MGC17344) (MaxLight 550)
132359-ML550 100 µL

RASSF5 (Ras Association Domain-containing Protein 5, New Ras Effector 1, Regulator for Cell Adhesion and Polarization Enriched in Lymphoid Tissues, RAPL, NORE1, MGC10823, MGC17344) (MaxLight 550)

Sign In for Pricing
View Details
CD3G Recombinant Rabbit mAb
BS46887 50 ul

CD3G Recombinant Rabbit mAb

Sign In for Pricing
View Details
Human PMF1 qPCR Primer Pair
QH33685S 200 Tests

Human PMF1 qPCR Primer Pair

Sign In for Pricing
View Details
DTX4, NT (RING Finger Protein 155, Protein Deltex-4, Deltex4, KIAA0937, RNF155)
D9644-04 200 µL

DTX4, NT (RING Finger Protein 155, Protein Deltex-4, Deltex4, KIAA0937, RNF155)

Sign In for Pricing
View Details
Aclarubicin-13CD3 discontinued
440911 500 µg

Aclarubicin-13CD3 discontinued

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus Bacteriocin helveticin-J (hlv)
MBS1155837-01 0.02 mg (E-Coli)

Recombinant Lactobacillus helveticus Bacteriocin helveticin-J (hlv)

Sign In for Pricing
View Details