Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Janthinobacterium sp. Protease HtpX homolog (htpX)

This Recombinant Janthinobacterium sp. Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A6SXH1

Expression Region

1-290

Origin

Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLFIATNIAVIAVMSVVLSLLGVDRFISQAGLNLPMLLVFSLVVGFTGSIISLLIS KPMAKWSTGARVIDAPSSSTELWLIDTVSKLAQRAGIKMPEVAVYDGEPNAFATGAFRDS ALVAVSTGLLQSMTKDEVEAVLAHEVAHVANGDMVTMTLVQGVVNTFVVFLSRVVGYFVD RAISRDNNNSQGIGYTITVIVSQIVFGIAASVIVAWFSRHREFRADAGAAKLLGSPQPMM KALARLGGIEPTSLPEGLASLGINDKPGFAALFSSHPPIEDRIAALRSLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC74B activation kit by CRISPRa
GA114112 1 Kit

Human CCDC74B activation kit by CRISPRa

Sign In for Pricing
View Details
OR51G1 Human Gene Knockout Kit (CRISPR)
KN417891 1 Kit

OR51G1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MIR3934 Human qPCR Primer Pair (MI0016590)
HP300905 200 Reactions

MIR3934 Human qPCR Primer Pair (MI0016590)

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-60516-01 60 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-60516-02 120 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-60516-03 200 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details