Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q669V7

Expression Region

1-293

Origin

Yersinia pseudotuberculosis

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMLVFGLVLSLTGIQSSSVQGLMIMAGLFGFGGAFVSLLMSKWMALR SVGGEVIERPRNETEYWLLETVRRQSQQVGIAMPQVAIYQAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHVANGDMVTMTLIQGVVNTFVIFISRLIAQIAAGFLSG DRDGESNSPGNPMVYFAVSMVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEAGSMMAFCINGKSKTFSELFMSHPPLDKRIEALRSGQYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog Trefoil factor 2 (TFF2) Elisa Kit
EK762081 96 Well

Dog Trefoil factor 2 (TFF2) Elisa Kit

Sign In for Pricing
View Details
CYP2E1 Antibody
OAAJ07357-100UL 100 µL

CYP2E1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Elk-1 [p Ser389] Antibody [Alexa Fluor 700]
NBP2-54759AF700 0.1 mL

Rabbit Polyclonal Elk-1 [p Ser389] Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Ganoderic acid B (Standard)
HY-N2006R 1 Each

Ganoderic acid B (Standard)

Sign In for Pricing
View Details
Guinea Pig Coronin 2A (CORO2A) ELISA kit
GTR10428198 96 Well

Guinea Pig Coronin 2A (CORO2A) ELISA kit

Sign In for Pricing
View Details
ENPEP Peptide - C-terminal region (AAP65562)
AAP65562-100UG 100 µg

ENPEP Peptide - C-terminal region (AAP65562)

Sign In for Pricing
View Details