Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 110 (TMEM110)

This Recombinant Human Transmembrane protein 110 (TMEM110) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Transmembrane protein 110

UniProt

Q86TL2

Expression Region

1-294

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFSTLMLKRFREP KHERRPWRIWFLDTSKQAIGMLFIHFANVYLADLTEEDPCSLYLINFLLDATVGMLLIYV GVRAVSVLVEWQQWESLRFGEYGDPLQCGAWVGQCALYIVIMIFEKSVVFIVLLILQWKK VALLNPIENPDLKLAIVMLIVPFFVNALMFWVVDNFLMRKGKTKAKLEERGANQDSRNGS KVRYRRAASHEESESEILISADDEMEESDVEEDLRRLTPLKPVKKKKHRFGLPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), CF488A conjugate, 0.1mg/mL
BNC882306-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apoptosis inhibitor 5 (API5) (NM_001142931) Human Over-expression Lysate
LY428299 100 µg

Apoptosis inhibitor 5 (API5) (NM_001142931) Human Over-expression Lysate

Sign In for Pricing
View Details
PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF804234 100 µg

PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details
Neurofilament (NF-L) (NR-4), 0.2mg/mL
BNUB0303-500 1x 500 µL

Neurofilament (NF-L) (NR-4), 0.2mg/mL

Sign In for Pricing
View Details
3-Formylphenylboronic Acid
TRC-F700970-5G 5 g

3-Formylphenylboronic Acid

Sign In for Pricing
View Details
Starch Debranching Enzyme (DBE) Activity Colorimetric Assay Kit
E-BC-K1206-M 96 T (40 samples)

Starch Debranching Enzyme (DBE) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details