Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction delta-2 protein (Gjd2)

This Recombinant Rat Gap junction delta-2 protein (Gjd2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Gap junction delta-2 protein, Connexin-36, Cx36, Gap junction alpha-9 protein

UniProt

O70610

Expression Region

1-321

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP AESIGGPGGTGGGGSGGSKREDKKLQNAIVNGVLQNTETTSKETEPDCLEVKELAPHPSG LRTAARSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSVYEIRNK DLPRVSVPNFGRTQSSDSAYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-)-Biotin Sulfoxide
TRC-B389045-250MG 250 mg

(-)-Biotin Sulfoxide

Sign In for Pricing
View Details
RAB37 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F1]
TA505311BM 100 µL

RAB37 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F1]

Sign In for Pricing
View Details
Azocarmine G
TRC-A932808-250MG 250 mg

Azocarmine G

Sign In for Pricing
View Details
STAT3 (C-term) Rabbit Polyclonal Antibody
AP23374PU-N 100 µg

STAT3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFRS11 Antibody
8C18926-AAT 50 µg

SFRS11 Antibody

Sign In for Pricing
View Details
GDF15 Recombinant Rabbit Monoclonal Antibody [JE39-90]
HA722551 100 µL

GDF15 Recombinant Rabbit Monoclonal Antibody [JE39-90]

Sign In for Pricing
View Details