Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc transporter 2 (SLC30A2)

This Recombinant Human Zinc transporter 2 (SLC30A2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Zinc transporter 2, ZnT-2, Solute carrier family 30 member 2

UniProt

Q9BRI3

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPD SHCDPKKGKAQRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISG DYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFM QSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTA VRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHT VTIQIEDYSEDMKDCQACQGPSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant VCAM1 Antibody
RC-4057-01 50 μL

Recombinant VCAM1 Antibody

Sign In for Pricing
View Details
Recombinant VCAM1 Antibody
RC-4057-02 100 µL

Recombinant VCAM1 Antibody

Sign In for Pricing
View Details
Recombinant VCAM1 Antibody
RC-4057-03 1 mL

Recombinant VCAM1 Antibody

Sign In for Pricing
View Details
SIRT3 Antibody
R31580 100 µg

SIRT3 Antibody

Sign In for Pricing
View Details
NIP30 (FAM192A) (NM_024946) Human Over-expression Lysate
LY403039 100 µg

NIP30 (FAM192A) (NM_024946) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF594 conjugate, 0.1mg/mL
BNC942148-100 1x 100 µL

Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details