Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sideroflexin-3 (SFXN3)

This Recombinant Human Sideroflexin-3 (SFXN3) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Sideroflexin-3

UniProt

Q9BWM7

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAG VVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTV VFWQWVNQSFNAIVNYSNRSGDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVG RFVPFAAVAAANCINIPLMRQRELQVGIPVADEAGQRLGYSVTAAKQGIFQVVISRICMA IPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATPLCCALFPQKSSIHISN LEPELRAQIHEQNPSVEVVYYNKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5W2 (NM_001001960) Human Over-expression Lysate
LY424293 100 µg

OR5W2 (NM_001001960) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Elk3 activation kit by CRISPRa
GA201224 1 Kit

Mouse Elk3 activation kit by CRISPRa

Sign In for Pricing
View Details
Glutathione Peroxidase 4 (GPX4) Activity Assay Kit
E-BC-K883-M-01 48 T (24 samples)

Glutathione Peroxidase 4 (GPX4) Activity Assay Kit

Sign In for Pricing
View Details
Glutathione Peroxidase 4 (GPX4) Activity Assay Kit
E-BC-K883-M-02 96 T (48 samples)

Glutathione Peroxidase 4 (GPX4) Activity Assay Kit

Sign In for Pricing
View Details
CalreticULin (CALR) Human Gene Knockout Kit (CRISPR)
KN203222RB 1 Kit

CalreticULin (CALR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711181 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details