Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea abies Photosystem Q (B) protein

This Recombinant Picea abies Photosystem Q (B) protein spans the amino acid sequence from region 2-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P50155

Expression Region

2-344

Origin

Picea abies (Norway spruce) (Picea excelsa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TAIIERRESANLWGRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENQSANAGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVAGIWFTALGISTMALNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(DHQD)2PHAL
TRC-D299905-500MG 500 mg

(DHQD)2PHAL

Sign In for Pricing
View Details
Pro Caspase-3 Recombinant Rabbit monoclonal Antibody
HA750048 100 µL

Pro Caspase-3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP500880 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details
Recombinant Human IL-21R Protein (His Tag)
PKSH033365-01 10 µg

Recombinant Human IL-21R Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-21R Protein (His Tag)
PKSH033365-02 50 µg

Recombinant Human IL-21R Protein (His Tag)

Sign In for Pricing
View Details
Ivacaftor Carboxylic Acid
TRC-I940605-1MG 1 mg

Ivacaftor Carboxylic Acid

Sign In for Pricing
View Details