Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein (psbA)

This Recombinant Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q1XDS5

Expression Region

1-344

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLQRRESASLWERFCSWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAAPPVDI DGIREPVAGSLLYGNNIISGAVIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLVVLHFL TGVACYIGREWELSYRLGMRPWISVAFTAPVAAAAAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETSENESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGLWPVVGIWLTALSVSTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pcdh1 Pre-designed siRNA Set B
SI210126B 1 Each

Rat Pcdh1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
WIPI1 Rabbit Polyclonal Antibody (HRP)
orb2099327 100 µL

WIPI1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SCARA5 Rabbit Polyclonal Antibody (Biotin)
orb2581332 100 µg

SCARA5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Easypro Human Fibroblast Growth Factor Receptor 4 (FGFR4) ELISA Kit
FY-EH2756S 96 Well

Easypro Human Fibroblast Growth Factor Receptor 4 (FGFR4) ELISA Kit

Sign In for Pricing
View Details
CD8a Antibody [OKT8] (FITC)
76-662 100 Tests

CD8a Antibody [OKT8] (FITC)

Sign In for Pricing
View Details
HAO1 Rabbit pAb
E47R8602 100 µL

HAO1 Rabbit pAb

Sign In for Pricing
View Details