Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q2FXE6

Expression Region

1-121

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLLTALTIAFFSNHPT LKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAVTSYVFGILLCYVGIKLGGGL S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carbonic anhydrase X (CA10) activation kit by CRISPRa
GA111281 1 Kit

Human Carbonic anhydrase X (CA10) activation kit by CRISPRa

Sign In for Pricing
View Details
N-Vanillylnonanamide-d3
TRC-V097637-1MG 1 mg

N-Vanillylnonanamide-d3

Sign In for Pricing
View Details
Metallurgical Microscope BMIC-803
BMIC-803 1 Unit

Metallurgical Microscope BMIC-803

Sign In for Pricing
View Details
DDIT3 Recombinant Rabbit Monoclonal Antibody [PSH07-65]
HA722854 100 µL

DDIT3 Recombinant Rabbit Monoclonal Antibody [PSH07-65]

Sign In for Pricing
View Details
Recombinant MBD2 Antibody
RC-16026-01 50 μL

Recombinant MBD2 Antibody

Sign In for Pricing
View Details
Recombinant MBD2 Antibody
RC-16026-02 100 µL

Recombinant MBD2 Antibody

Sign In for Pricing
View Details