Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q2FXE6

Expression Region

1-121

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLLTALTIAFFSNHPT LKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAVTSYVFGILLCYVGIKLGGGL S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Notch3 Mouse Gene Knockout Kit (CRISPR)
KN311126LP 1 Kit

Notch3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MAX/MYC associated factor X Monoclonal Antibody
AN300263P 100 µL

Recombinant MAX/MYC associated factor X Monoclonal Antibody

Sign In for Pricing
View Details
CD99 / MIC2 (Ewing's Sarcoma Marker), CF405S conjugate, 0.1mg/mL
BNC041646-100 1x 100 µL

CD99 / MIC2 (Ewing's Sarcoma Marker), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DUSP4 (NM_001394) Human Over-expression Lysate
LY400543 100 µg

DUSP4 (NM_001394) Human Over-expression Lysate

Sign In for Pricing
View Details
ViPrimePLUS AtTaq qPCR Green Master Mix II, 150rxns
QLMM07 150 Reactions

ViPrimePLUS AtTaq qPCR Green Master Mix II, 150rxns

Sign In for Pricing
View Details
SFRS14 (SUGP2) (NM_001017392) Human Over-expression Lysate
LY422773 100 µg

SFRS14 (SUGP2) (NM_001017392) Human Over-expression Lysate

Sign In for Pricing
View Details