Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycerol dehydrogenase small subunit (sldB)

This Recombinant Glycerol dehydrogenase small subunit (sldB) spans the amino acid sequence from region 2-126.

Product Specifications

Product Name Alternative

Glycerol dehydrogenase small subunit, EC= 1.1.99.22, D-arabitol dehydrogenase small subunit, ARDH, D-sorbitol dehydrogenase subunit sldB, SLDH, Gluconate/polyol

UniProt

Q8L1D5

Expression Region

2-126

Origin

Gluconobacter thailandicus

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PNLQGNRTLTEWLTLLLGVIVLLVGLFFVIGGADLAMLGGSTYYVLCGILLVASGVFMLM GRTLGAFLYLGALAYTWVWSFWEVGFSPIDLLPRAFGPTILGILVALTIPVLRRMESRRT LRGAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trfp (BC060122) Mouse Tagged ORF Clone
MG200965 10 µg

Trfp (BC060122) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Phospho-Tau (Thr217) Monoclonal Antibody
AN300377L-01 20 µL

Recombinant Phospho-Tau (Thr217) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-Tau (Thr217) Monoclonal Antibody
AN300377L-02 100 µL

Recombinant Phospho-Tau (Thr217) Monoclonal Antibody

Sign In for Pricing
View Details
UQCRB Human Gene Knockout Kit (CRISPR)
KN402685 1 Kit

UQCRB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated Mouse CCL3 Recombinant Rabbit Monoclonal Antibody [PSH08-40] - Detector
HA722984B 100 µL

Biotin Conjugated Mouse CCL3 Recombinant Rabbit Monoclonal Antibody [PSH08-40] - Detector

Sign In for Pricing
View Details
Benzoyl Chloride
TRC-B209550-500ML 500 mL

Benzoyl Chloride

Sign In for Pricing
View Details