Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Probable lipid phosphate phosphatase PPAPDC3 (Ppapdc3)

This Recombinant Rat Probable lipid phosphate phosphatase PPAPDC3 (Ppapdc3) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Probable lipid phosphate phosphatase PPAPDC3, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 3

UniProt

Q5FVJ3

Expression Region

1-271

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVSQSRARARDRNNVLNRAEFLSLNQPPKGTQEPRSSGRKASGPSTQPPPSSDGARERR QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITS HGIPWIGGTILCLVRSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPGLLD YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDV ISGFIIGYFQFRLVELVWMSSNTCQMLISAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCTR3
HY-125516-01 10 μg (215.69 μM x 100 μL in Ethanol) )

MCTR3

Sign In for Pricing
View Details
MCTR3
HY-125516-02 25 μg (215.69 μM x 250 μL in Ethanol)

MCTR3

Sign In for Pricing
View Details
Presenilin 1 (Presenilin-1, PS1, PS-1, PSEN1, PSNL1, Alzheimer Disease 3, AD3, Ad3h, FAD, Protein S182, S182, S182 Protein) (MaxLight 550) discontinued
P6300-28E-ML550 100 µL

Presenilin 1 (Presenilin-1, PS1, PS-1, PSEN1, PSNL1, Alzheimer Disease 3, AD3, Ad3h, FAD, Protein S182, S182, S182 Protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal TREX2 Antibody [DyLight 680]
NBP1-76978FR 0.1 mL

Rabbit Polyclonal TREX2 Antibody [DyLight 680]

Sign In for Pricing
View Details
MNF1 Recombinant Protein (Human)
RP075447 100 µg

MNF1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Gazella gazella Cytochrome c oxidase subunit 3 (MT-CO3)
MBS7021707-01 0.02 mg

Recombinant Gazella gazella Cytochrome c oxidase subunit 3 (MT-CO3)

Sign In for Pricing
View Details