Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q9TM16

Expression Region

1-278

Origin

Cyanidium caldarium

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNWKFNKINYPTFEKSGAIPRSITKTFEKLKKELNPHSESEIIEEFTISRYQTIASLRY LIVLVVFPVVVHQVSKNFIIGPAVDYFWKYNQIDVFLNSSQEERAFAELQRFEEKIHFEM LIGTKQSVSQQSLEASIKQKAVEIADHYTYESLHAIKNILADSISISVFILLIVLGKRQT FVLKSFLNEIVYGLSDTAKAFLIILFTDMFIGFHSPHGWEVVIESLLRHFGLPENRDFIF LFIATFPVSLDTVFKYWIFRYLNQVSPSAVATYHNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reinforced Medium for Clostridia
MH443-100G 100 g

Reinforced Medium for Clostridia

Sign In for Pricing
View Details
Human ZNF623 knockout cell line
ABC-KH17682 1 Vial

Human ZNF623 knockout cell line

Sign In for Pricing
View Details
MAP4K5 (NM_198794) Human Recombinant Protein
PH39111M5 20 µg

MAP4K5 (NM_198794) Human Recombinant Protein

Sign In for Pricing
View Details
WFDC-1 (186-220) (Human)
012-65 100 µg

WFDC-1 (186-220) (Human)

Sign In for Pricing
View Details
CD247 Recombinant Monoclonal Antibody
A78121-50UL 50 μL

CD247 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
HEK293-Dog-CD274-Flag Overexpressing Cell Line
RG-1024 5x 10^6

HEK293-Dog-CD274-Flag Overexpressing Cell Line

Sign In for Pricing
View Details