Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein YIPF3 (YIPF3)

This Recombinant Chicken Protein YIPF3 (YIPF3) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Protein YIPF3, YIP1 family member 3

UniProt

Q5F384

Expression Region

1-336

Origin

Gallus gallus (Chicken)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAPGGGRSGPAEWGGFEDNMQGGGSAVIDMENMDDTSGSSFEDMGEMHQRMKEEEEEEA EGEAGAGGEEDGEFLGMKGLQGQLGRQVADQMWQVGKRQASKAFSLYANIDILRPYFDVE PVQVRTRLLESMVPVKMINFPQKIAGELYGPLMLVFTLVAILLHGMKTSDTIIREGTLMG TAIGTCFGYWLGVSSFIYFLAYLCNAQITMVQMLSLLGYGLFGHCITLLVTYNIHFHSLF YIFWLVVGGLSTLRMVAVLVSRTVGHTQRLILCGTLAALHMLFLLYLHFAYHKVVEGILD TLEGPNMPPFQRVARDIPVVSNAVLNTTAKANAMTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAPGEFL1 Peptide - middle region
orb2002840 100 µg

RAPGEFL1 Peptide - middle region

Sign In for Pricing
View Details
PAFAH1B2 Rabbit Polyclonal Antibody (BF680)
orb2372070 100 µL

PAFAH1B2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
CYHR1 Protein Vector (Mouse) (pPB-N-His)
PV169371 500 ng

CYHR1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Regulated On Activation In Normal T-Cell Expressed And Secreted (CCL5, SISd, eoCP, SCYA5, RANTES, TCP228, D17S136E, SIS-delta) (MaxLight 550)
MBS6435347-01 0.1 mL

Regulated On Activation In Normal T-Cell Expressed And Secreted (CCL5, SISd, eoCP, SCYA5, RANTES, TCP228, D17S136E, SIS-delta) (MaxLight 550)

Sign In for Pricing
View Details
Regulated On Activation In Normal T-Cell Expressed And Secreted (CCL5, SISd, eoCP, SCYA5, RANTES, TCP228, D17S136E, SIS-delta) (MaxLight 550)
MBS6435347-02 5x 0.1 mL

Regulated On Activation In Normal T-Cell Expressed And Secreted (CCL5, SISd, eoCP, SCYA5, RANTES, TCP228, D17S136E, SIS-delta) (MaxLight 550)

Sign In for Pricing
View Details
Anti Human CD41 Flow Cytometry Monoclonal Clone HIP8 Biotin 25ug
IMSAHUCD41HIP8CBL25UG 25 µg

Anti Human CD41 Flow Cytometry Monoclonal Clone HIP8 Biotin 25ug

Sign In for Pricing
View Details