Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEFL1 Peptide - middle region

RAPGEFL1 Peptide - middle region

Product Specifications

Product Name Alternative

RAPGEFL1

UniProt

Q9UHV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAPGEFL1 Rabbit Polyclonal Antibody (orb587733) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057423

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLHQLVETVELKIPEENQPPSKQVKPLFRHFRRIDSCLQTRVAFRGSDEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Methyl-5-nitro-2,3-dihydro-1H-indol-2-one
VAA87089-01 250 mg

1-Methyl-5-nitro-2,3-dihydro-1H-indol-2-one

Sign In for Pricing
View Details
1-Methyl-5-nitro-2,3-dihydro-1H-indol-2-one
VAA87089-02 2.5 g

1-Methyl-5-nitro-2,3-dihydro-1H-indol-2-one

Sign In for Pricing
View Details
Lauryl glucoside
110615-47-9 1 Each

Lauryl glucoside

Sign In for Pricing
View Details
Recombinant Solanum tuberosum Cytochrome b559 subunit alpha (psbE)
orb2936131-01 20 µg

Recombinant Solanum tuberosum Cytochrome b559 subunit alpha (psbE)

Sign In for Pricing
View Details
Recombinant Solanum tuberosum Cytochrome b559 subunit alpha (psbE)
orb2936131-02 100 µg

Recombinant Solanum tuberosum Cytochrome b559 subunit alpha (psbE)

Sign In for Pricing
View Details
LOC100364438 3'UTR Luciferase Stable Cell Line
TU209099 1.0 mL

LOC100364438 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details