Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin-16 (inx-16)

This Recombinant Innexin-16 (inx-16) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Innexin-16, Protein opu-16

UniProt

O61787

Expression Region

1-372

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMLGNIKTYAQTVTSLSDNDDTSIDRLNYVVTTSILIAFSLLLFAKNYVGEPMQCWTPN QFAGGWESFAESYCFIENTYFVPMQDSNLPAAETREGREMIYYQWVPFLLVIQALFFCVP RAFWIIYPSYSGLTIADMITAARQNGKQLEGADEALEQVAMINWRTEQQKGHGSRIFNCY LVMKLLILLNIVLQFFLLNSFLNTAYTFWGWGIFWDMVNGRHWQESGHFPRVSFCDINVR ELGNIHHWSLQCVLMVNMFNEKIFIFLWFWFAFLLVATAGDFVIWVWRRFDSNSKLGFIL DLLNQEGIDHSPQKASELYKNVLRDDGVLFLRLLDSNSGRLNSEELMKKIYNISVGHATD LNTPIEEHATSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human UFSP1 protein
ATGP1856-050 50 µg

Recombinant human UFSP1 protein

Sign In for Pricing
View Details
Mouse Ccdc33 ELISA KIT
ELI-33064m 96 Tests

Mouse Ccdc33 ELISA KIT

Sign In for Pricing
View Details
Lentiviral human CNOT11 sgRNA gene knockout kit - Lentiviral human CNOT11 sgRNA gene knockout kit (25)
GTR15376329 1 Vial

Lentiviral human CNOT11 sgRNA gene knockout kit - Lentiviral human CNOT11 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
TCR alpha/beta Antibody (PerCP)
orb154538 100 Tests

TCR alpha/beta Antibody (PerCP)

Sign In for Pricing
View Details
SLC18A3 Protein Vector (Mouse) (pPB-N-His)
PV229867 500 ng

SLC18A3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
TCEAL5 Peptide - middle region (AAP50725)
AAP50725-100UG 100 µg

TCEAL5 Peptide - middle region (AAP50725)

Sign In for Pricing
View Details