Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype A3 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype A3 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q4R1S6

Expression Region

2-400

Origin

Hepatitis B virus genotype A3 (isolate Cameroon/CMR983/1994) (HBV-A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKDHWPQANQVGVG AFGPGFTPPHGGVLGWSPQAQGTLTTVPAVPPPASANRQSGRQPTPISPPLRDSHPQAIK WNSPAFHQALQDPRVKGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTP AQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antibacterial agent 128
HY-151944 1 Each

Antibacterial agent 128

Sign In for Pricing
View Details
Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)
RPU43443-01 50 µg

Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)

Sign In for Pricing
View Details
Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)
RPU43443-02 100 µg

Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)

Sign In for Pricing
View Details
Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)
RPU43443-03 1 mg

Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9)

Sign In for Pricing
View Details
BAG2 Antibody
A13814-50UL 50 μL

BAG2 Antibody

Sign In for Pricing
View Details
NAT10 Antibody / N-acetyltransferase-like protein / ALP (N-Terminal Region)
F54186-0.05ML 0.05 mL

NAT10 Antibody / N-acetyltransferase-like protein / ALP (N-Terminal Region)

Sign In for Pricing
View Details