Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase (icaA) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthase, PNAG synthase, Poly-beta-1,6-GlcNAc synthase, EC= 2.4.1.-, Biofilm polysaccharide intercellular adhesin synthesis protei

UniProt

Q99QX3

Expression Region

1-412

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRRG1 activation kit by CRISPRa
GA103820 1 Kit

Human PRRG1 activation kit by CRISPRa

Sign In for Pricing
View Details
MRRF Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A9]
TA806103BM 100 µL

MRRF Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A9]

Sign In for Pricing
View Details
AKR1C1 Recombinant Mouse Monoclonal Antibody [5-F10-R]
HA601174 100 µL

AKR1C1 Recombinant Mouse Monoclonal Antibody [5-F10-R]

Sign In for Pricing
View Details
RPL36 (N-term) Rabbit Polyclonal Antibody
AP53718PU-N 400 µL

RPL36 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF594 conjugate, 0.1mg/mL
BNC942304-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLK1 (Marker of Mitosis) (AZ44), CF647 conjugate, 0.1mg/mL
BNC473101-100 1x 100 µL

PLK1 (Marker of Mitosis) (AZ44), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details