Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Chloroplast envelope membrane protein (cemA)

This Recombinant Marchantia polymorpha Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-434.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

P12211

Expression Region

1-434

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKNFSYWRIFHHIFALPYCSLEKAYKASKRIQKIKKDYFLYKNILFSSKRSWQSILFYI DTELNNSVFKIYLSLLEYKLSLWLIQLFLIFSLFFKKNSKFDLILPNINEKKKKRKINRK LAWIRATLNDLESWRRYYLFSSFLSLDKKEKNNFSFLQMKSSRLTAIAYESIGLVPRSIT RTFSRFKAELTNQSSSLVLKEFRLAKYQALASLQYIGCLFFIPLGVSFFFQKCFLEPWIQ NWWNIYQSQIFLTSFQEEKALKKLQEIEELFWLDKVMTYSSNKIQLQDLTKEIHQQTIEL VQIYNNDSIKIVLHLLTDLIWFITLSCLFILGKERLVILNSWAQELFYSLSDTMKAFFIL LLTDLCIGFHSPHGWEIVISSCLEHFGFVHNKHVISCFVSTFPVILDTVFKYLIFRHLNR ISPSIVATYHTMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Tissue Polypeptide Antigen ELISA kit
GTR10416233 96 Well

Canine Tissue Polypeptide Antigen ELISA kit

Sign In for Pricing
View Details
Porcine heat shock protein 90kDa β (Grp94), member 1 (HSP90B1) ELISA kit
GTR10476056 96 Well

Porcine heat shock protein 90kDa β (Grp94), member 1 (HSP90B1) ELISA kit

Sign In for Pricing
View Details
Rat Baculoviral IAP repeat containing protein 4 (XIAP) ELISA kit
GTR10371040 96 Well

Rat Baculoviral IAP repeat containing protein 4 (XIAP) ELISA kit

Sign In for Pricing
View Details
Complement C8G, Human (His, solution)
HY-P7824-01 10 µg

Complement C8G, Human (His, solution)

Sign In for Pricing
View Details
Complement C8G, Human (His, solution)
HY-P7824-02 50 µg

Complement C8G, Human (His, solution)

Sign In for Pricing
View Details
Human Nfatc2 (Nuclear Factor Of Activated T-Cells, Cytoplasmic 2) ELISA Kit
FY-EH4278 96 Well

Human Nfatc2 (Nuclear Factor Of Activated T-Cells, Cytoplasmic 2) ELISA Kit

Sign In for Pricing
View Details