Complement C8G, Human (His, solution)
C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. C8G/C8 γ is a neuroinflammation inhibitor that interacts with S1PR2 and jointly antagonizes the pro-inflammatory activity of S1P in microglia. Complement C8G Protein, Human (His, solution) is the recombinant human-derived Complement C8G protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Complement C8G Protein, Human (His, solution), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/complement-c8g-protein-human-his.html
Purity
98.0
Smiles
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Molecular Formula
733 (Gene_ID) AAI13627.1 (Q21-R202) (Accession)
Molecular Weight
Approximately 22.0-23.0 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7013364-01 0.02 mg
Recombinant Mouse Cytochrome b5 type B (Cyb5b)
Sign In for Pricing
View Details MBS7013364-02 0.1 mg
Recombinant Mouse Cytochrome b5 type B (Cyb5b)
Sign In for Pricing
View Details MBS7013364-03 5x 0.1 mg
Recombinant Mouse Cytochrome b5 type B (Cyb5b)
Sign In for Pricing
View Details