Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycosyltransferase alg8 (alg8)

This Recombinant Glycosyltransferase alg8 (alg8) spans the amino acid sequence from region 1-492.

Product Specifications

Product Name Alternative

Glycosyltransferase alg8, EC= 2.4.-.-

UniProt

P94199

Expression Region

1-492

Origin

Azotobacter vinelandii

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRLKHALGEATGWLLFLSFLMLVAVALPPQVFDPESKHFIMLIGLIGVWRYSMGIIHFL RGMLFLYVVYPYYRRKVEKLGKDADPSHVFLMVTSFRIDALTTGKVYGSVIKEAINCGYP TTVVCSIVEMSDELLIKSLWEKLDPPDRVKLDFVRIAGTGKRDGLANGFRAISRHMPDED AVVAVIDGDTVLNEGVVRKTVPLFQDLPQHGWPDHQRILRSAGRLRHERVAQVRFAQRHI NMCSMALSHRVLTLTGRMSVFRAVVTDPEFIVDVENDNLDHWRLGRFKFLTGDDKSSWFS LMRLGYDTFYVPDASIHTVEHPPEKRFVKASRKLMFRWYGNNLRQNSRALKLGVQRLGWF TSVVLFDQRVSMWTSLLGLTVAIIGSIKYSIAIFIAYLLWVCSTRLVLTLLLSLSGHPIG PAYPLILYYNQIVGAVVKIHVFFRLDQQSWTRQDTKLNRELASFQSWFNNWSSKAMTFSA TSIFIAVLMLSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LI -Cadherin
HAR359-3ml 3 mL

LI -Cadherin

Sign In for Pricing
View Details
P4HB Peptide - C-terminal region
orb1997603 100 µg

P4HB Peptide - C-terminal region

Sign In for Pricing
View Details
Human Interleukin 4, IL-4 ELISA Kit
NB-E10142-01 96 Well

Human Interleukin 4, IL-4 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 4, IL-4 ELISA Kit
NB-E10142-02 96 Well

Human Interleukin 4, IL-4 ELISA Kit

Sign In for Pricing
View Details
Canine A Disintegrin Like and Metalloproteinase With Thrombospondin Type 1 Motif 4 ELISA Kit
MBS028730-01 48 Well

Canine A Disintegrin Like and Metalloproteinase With Thrombospondin Type 1 Motif 4 ELISA Kit

Sign In for Pricing
View Details
Canine A Disintegrin Like and Metalloproteinase With Thrombospondin Type 1 Motif 4 ELISA Kit
MBS028730-02 96 Well

Canine A Disintegrin Like and Metalloproteinase With Thrombospondin Type 1 Motif 4 ELISA Kit

Sign In for Pricing
View Details