Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HB Peptide - C-terminal region

P4HB Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDI, Thbp, ERp59, Pdia1

UniProt

P09103

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035162.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGERTLDGFKKFLESGGQDGAGDDEDLDLEEALEPDMEEDDDQKAVKDEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epstein-Barr Virus (LMP-1) (CS1), CF740 conjugate, 0.1mg/mL
BNC741741-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Inhibin alpha (INHA) Mouse Monoclonal Antibody [Clone ID: R1]
AM10098SU-N 1 mL

Inhibin alpha (INHA) Mouse Monoclonal Antibody [Clone ID: R1]

Sign In for Pricing
View Details
Human IgM Immunoglobulin (ICO-30), CF640R conjugate, 0.1mg/mL
BNC400364-100 1x 100 µL

Human IgM Immunoglobulin (ICO-30), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ccnd3 Mouse Gene Knockout Kit (CRISPR)
KN502811 1 Kit

Ccnd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RTKN (NM_001015055) Human Over-expression Lysate
LY423121 100 µg

RTKN (NM_001015055) Human Over-expression Lysate

Sign In for Pricing
View Details
Didecylamine
TRC-D439430-5G 5 g

Didecylamine

Sign In for Pricing
View Details