Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. doylei UPF0059 membrane protein JJD26997_0180 (JJD26997_0180)

This Recombinant Campylobacter jejuni subsp. doylei UPF0059 membrane protein JJD26997_0180 (JJD26997_0180) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

UPF0059 membrane protein JJD26997_0180

UniProt

A7H1P4

Expression Region

1-187

Origin

Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFYSLIFLSCALGMDAFAVSLCKSFSVKKLHLKHYLIVGIYFGGFQALMPTIGYFIGIT FASFIASIDHWIAFILLSLIGLKMIKESLENENCNSNAKQFGFKTMLALAIATSIDALAV GVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNKAELLGGLVLIILGVKIL IEHLFFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: right
CS510563 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
DNA-PK Antibody
8C0174-AAT 50 µg

DNA-PK Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Cecum
CS805266 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS623234 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Thiolutin
SIH-375-1MG 1 mg

Thiolutin

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), 0.2mg/mL
BNUB0726-100 1x 100 µL

DOG-1 (DG1/447 + DOG1.1), 0.2mg/mL

Sign In for Pricing
View Details