Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfA (rnfA)

This Recombinant Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

P65543

Expression Region

1-193

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR67 Protein Vector (Mouse) (pPM-C-HA)
PV247180 500 ng

WDR67 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
COQ2 Protein Vector (Rat) (pPM-C-HA)
16642026 500 ng

COQ2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
[D-Ala2, DMet5] Enkephalin [Tyr-D-Ala-Gly-Phe-D-Met; MW: 587.70]
SP-101793-5 5 mg

[D-Ala2, DMet5] Enkephalin [Tyr-D-Ala-Gly-Phe-D-Met; MW: 587.70]

Sign In for Pricing
View Details
3,6-diamino-N- (4-bromophenyl) -5-cyano-4- (furan-2-yl) thieno[2,3-b]pyridine-2-carboxamide
sc-347447 250 mg

3,6-diamino-N- (4-bromophenyl) -5-cyano-4- (furan-2-yl) thieno[2,3-b]pyridine-2-carboxamide

Sign In for Pricing
View Details
Mouse Monoclonal PGM3 Antibody (OTI5C6) [Alexa Fluor 594]
NBP2-73364AF594 0.1 mL

Mouse Monoclonal PGM3 Antibody (OTI5C6) [Alexa Fluor 594]

Sign In for Pricing
View Details
Monoclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)
TRV-0032335-01 20 µL

Monoclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)

Sign In for Pricing
View Details