Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus somnus Electron transport complex protein RnfA (rnfA)

This Recombinant Haemophilus somnus Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q0I487

Expression Region

1-193

Origin

Haemophilus somnus (strain 129Pt) (Histophilus somni (strain 129Pt) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMGLATMFVLTVASLCAYLVE HYLLTPLHANFLRTLIFILVIAVVVQFTEMVIHKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINLAHNLTQSVIYGFSASLGFSLVLVLFAALRERLTAADIPLPFRGASIALITAGLM SLAFMGFSGLVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5031439G07Rik Mouse Gene Knockout Kit (CRISPR)
KN500464 1 Kit

5031439G07Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTF1-Specific antibody
FNab08928 100 µg

TTF1-Specific antibody

Sign In for Pricing
View Details
LHX8 (1-321) Rabbit Polyclonal Antibody
AP23614PU-N 50 µL

LHX8 (1-321) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COL1A1 Recombinant Rabbit monoclonal Antibody
HA751058 100 µL

COL1A1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
2,4,5,2',3',4'-Hexachlorobiphenyl
TRC-H290948-10MG 10 mg

2,4,5,2',3',4'-Hexachlorobiphenyl

Sign In for Pricing
View Details
AFRed 780 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody
RD30285F-01 25 µg

AFRed 780 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody

Sign In for Pricing
View Details