Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter carbinolicus Electron transport complex protein RnfA (rnfA)

This Recombinant Pelobacter carbinolicus Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q3A7W6

Expression Region

1-193

Origin

Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLLLILIGAVLVNNFVLARFLGLCPFLGVSRKVETALGMGMAVTFVMVVASGCTWVLQ YLVLTPYHLDYLQTIAFILVIATLVQMVEMIVRKSSPVLYQSLGIFLPLITTNCAVLGLA VLNIQQGYSFVQSLVFAFGGAVGFTLALVLFAGLRERLRLCPVPAAFRGTPIELITAGLL ALAFMGFAGLVPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ras-related protein Rab-21 RAB21 Antibody
A05683 0.1 mg

Anti-Ras-related protein Rab-21 RAB21 Antibody

Sign In for Pricing
View Details
CD40 Human
PT-A00798-01 2 µg

CD40 Human

Sign In for Pricing
View Details
CD40 Human
PT-A00798-02 10 µg

CD40 Human

Sign In for Pricing
View Details
CD40 Human
PT-A00798-03 1 mg

CD40 Human

Sign In for Pricing
View Details
Aplithianines A
T82984-01 5 mg

Aplithianines A

Sign In for Pricing
View Details
Aplithianines A
T82984-02 50 mg

Aplithianines A

Sign In for Pricing
View Details