Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q46JD9

Expression Region

1-198

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLLILFFGYLFGSFPSGYLAGRIAKGIDIRSLGSGSTGATNVLRHIGKRAAITVFLLDV FKGVLSILLAKYLLLNDSWQVAVGLSTLIGHIWPVWLNWKGGKAVATGLGIFLGLSWQVG LATLGVFIIMITLFRIVSLASVSASLALPLIMFLSFSGSNLSLPFLIVSLLAMILVIWRH RENIVRLIRGKEPRIGQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-215-3p Vector
mh31295 500 ng

LentimiRa-Off-hsa-miR-215-3p Vector

Sign In for Pricing
View Details
OsI_35550 Antibody
orb841134 2 mg

OsI_35550 Antibody

Sign In for Pricing
View Details
KCNK10 (NM_021161) Human Tagged Lenti ORF Clone
RC222775L3 10 µg

KCNK10 (NM_021161) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Pomalidomide-C7-NH2 (hydrochloride)
HY-131878-01 5 mg

Pomalidomide-C7-NH2 (hydrochloride)

Sign In for Pricing
View Details
Pomalidomide-C7-NH2 (hydrochloride)
HY-131878-02 10 mg

Pomalidomide-C7-NH2 (hydrochloride)

Sign In for Pricing
View Details
Pomalidomide-C7-NH2 (hydrochloride)
HY-131878-03 25 mg

Pomalidomide-C7-NH2 (hydrochloride)

Sign In for Pricing
View Details