Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ochrobactrum anthropi ATP synthase subunit a 1 (atpB1)

This Recombinant Ochrobactrum anthropi ATP synthase subunit a 1 (atpB1) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a 1, ATP synthase F0 sector subunit a 1, F-ATPase subunit 6 1

UniProt

A6WW77

Expression Region

1-249

Origin

Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVVASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFLGLFPYFYTVTSQIIVTFAL AVLVIGTVIVYGFFKHGLGFLKLFVPSGVPGIIVPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLAALGPIGIGGAVLPLIMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC13L1 (SEC13) (Center) Rabbit Polyclonal Antibody
AP53829PU-N 400 µL

SEC13L1 (SEC13) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QuantiChrom™ Protein Assay Kit
QCPR-500 500 Tests

QuantiChrom™ Protein Assay Kit

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF647 conjugate, 0.1mg/mL
BNC473607-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cend1 (NM_021316) Mouse Tagged ORF Clone
MG201037 10 µg

Cend1 (NM_021316) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CALmL5 (NM_017422) Human Recombinant Protein
TP304372 20 µg

CALmL5 (NM_017422) Human Recombinant Protein

Sign In for Pricing
View Details
Adiponectin Recombinant Rabbit Monoclonal Antibody [PSH05-48]
HA722286 100 µL

Adiponectin Recombinant Rabbit Monoclonal Antibody [PSH05-48]

Sign In for Pricing
View Details