Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis ATP synthase subunit a (atpB)

This Recombinant Brucella suis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B0CK70

Expression Region

1-249

Origin

Brucella suis (strain ATCC 23445 / NCTC 10510)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aspartic Acid Diethyl Ester
TRC-A790170-5G 5 g

Aspartic Acid Diethyl Ester

Sign In for Pricing
View Details
a-Oxobenzenepropanoic Acid
TRC-O572000-2.5G 2.5 g

a-Oxobenzenepropanoic Acid

Sign In for Pricing
View Details
OR52K1 Antibody
8G858-AAT 50 µg

OR52K1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS632328 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
RPL10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9A8]
TA807673AM 100 µL

RPL10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9A8]

Sign In for Pricing
View Details
MGST1 Mouse Monoclonal Antibody [14H2]
EM1901-13 100 µL

MGST1 Mouse Monoclonal Antibody [14H2]

Sign In for Pricing
View Details