Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fat storage-inducing transmembrane protein 2 (FITM2)

This Recombinant Human Fat storage-inducing transmembrane protein 2 (FITM2) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 2, Fat-inducing protein 2

UniProt

Q8N6M3

Expression Region

1-262

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYF VKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGS CYQSPALEGVRKEHQSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDR SHCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLSWYGTYGFWYPK AFSPGLPPQSCSLNLKQDSYKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2S,4R)-4-Ethyl-L-proline Hydrochloride
TRC-E925650-10MG 10 mg

(2S,4R)-4-Ethyl-L-proline Hydrochloride

Sign In for Pricing
View Details
IFNB1 Polyclonal Antibody
E-AB-53491-01 20 µL

IFNB1 Polyclonal Antibody

Sign In for Pricing
View Details
IFNB1 Polyclonal Antibody
E-AB-53491-02 60 µL

IFNB1 Polyclonal Antibody

Sign In for Pricing
View Details
IFNB1 Polyclonal Antibody
E-AB-53491-03 120 µL

IFNB1 Polyclonal Antibody

Sign In for Pricing
View Details
IFNB1 Polyclonal Antibody
E-AB-53491-04 200 µL

IFNB1 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS629873 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details