Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB)

This Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein BexB

UniProt

P22235

Expression Region

1-265

Origin

Haemophilus influenzae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYGDKTTFKQSLAIQGRVINALLMREIITRYGRQNIGFFWLFVEPLLMTFFIVMMWKFI RADKFSTLNMIAFVMTGYPMAMMWRNASNRAIGSISANLSLLYHRNVRVLDTIFTRVLLE VAGASIAQILFMAILVMIDWIDAPHDVFYMLIAWFLMAMFAFALGLIICAIAQQFDVFGK IWGTLSFVLLPISGAFFFVHNLPAQAQSIALWFPMIHGTEMFRHGYFGDTVVTYESIGFL VVSDLALLLLGLVMVKNFSKGVEPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Carbonyl-L-Tyrosine Anhydride
TRC-C177300-1G 1 g

N-Carbonyl-L-Tyrosine Anhydride

Sign In for Pricing
View Details
Recombinant Human ACP1/LMW-PTP Protein (His Tag)
PKSH033598-01 10 µg

Recombinant Human ACP1/LMW-PTP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ACP1/LMW-PTP Protein (His Tag)
PKSH033598-02 50 µg

Recombinant Human ACP1/LMW-PTP Protein (His Tag)

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF405S conjugate, 0.1mg/mL
BNC041620-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Violet™ LCS1 *5 mM DMSO Solution*
17543-AAT 0.5 mL

Nuclear Violet™ LCS1 *5 mM DMSO Solution*

Sign In for Pricing
View Details
Caspase 9 (CASP9) Human Gene Knockout Kit (CRISPR)
KN400635 1 Kit

Caspase 9 (CASP9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details