Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter arcticus ATP synthase subunit a (atpB)

This Recombinant Psychrobacter arcticus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q4FQ31

Expression Region

1-288

Origin

Psychrobacter arcticus (strain DSM 17307 / 273-4)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGEQTTTEYISHHLTNWTYGYLPGEGWKVAYTAEEASAMGFKAIHLDSMLWSIGLGIVF CAIFWMVARKVTSGVPGKLQAAVEMIIEFVDNNVRDSYSGTSKLIAPLALTIFVWIFLMN LMDLLPVDFVPGLAGQIGAMMGHDPHHVFFKIVPTTDPNITLGMSFSVFILILFYSIKEK GLGGFVGELTLHPFSAKNPIVQIILIPINFILEFVTLIAKPISLGLRLFGNMYAGELIFI LIALMPFWIQWALSVPWAIFHILIITLQAFVFMMLTIVYMSLASSTEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B1]
TA805350BM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B1]

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]
TA808358BM 100 µL

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]

Sign In for Pricing
View Details
APC Anti-Human CD64 Antibody[10.1]
E-AB-F1082E-01 20 Tests

APC Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
APC Anti-Human CD64 Antibody[10.1]
E-AB-F1082E-02 100 Tests

APC Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
APC Anti-Human CD64 Antibody[10.1]
E-AB-F1082E-03 2x 100 Tests

APC Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF568 conjugate, 0.1mg/mL
BNC680896-500 1x 500 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details